General Information

  • ID:  hor005647
  • Uniprot ID:  O09210
  • Protein name:  Bombyxin-related peptide B chain B
  • Gene name:  NA
  • Organism:  Agrius convolvuli (Convolvulus hawk-moth)
  • Family:  insulin family
  • Source:  animal
  • Expression:  Located in 4 pairs of medial neurosecretory cells in the brain.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Agrius (genus), Acherontiini (tribe), Sphinginae (subfamily), Sphingidae (family), Bombycoidea (superfamily), Obtectomera, Ditrysia, Heteroneura (parvorder), Neolepidoptera (infraorder), Glossata (suborder), Lepidoptera (order), Amphiesmenoptera (superorder), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0008083 growth factor activity; GO:0018445 prothoracicotrophic hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  NNYCGRHLSETLAYMCPELEGAS
  • Length:  23(22-44)
  • Propeptide:  MKFVLVLVSLALLVSLASVQGNNYCGRHLSETLAYMCPELEGASKRSGAMGAAAMYGTRGWRWAAMGGNRGKRGVVEECCYQSCTLDELLTYC
  • Signal peptide:  MKFVLVLVSLALLVSLASVQG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-O09210-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005647_AF2.pdbhor005647_ESM.pdb

Physical Information

Mass: 295143 Formula: C107H164N30O37S3
Absent amino acids: DFIKQVW Common amino acids: EL
pI: 4.47 Basic residues: 2
Polar residues: 11 Hydrophobic residues: 5
Hydrophobicity: -46.09 Boman Index: -3777
Half-Life: 1.4 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 59.57
Instability Index: 5765.65 Extinction Coefficient cystines: 3105
Absorbance 280nm: 141.14

Literature

  • PubMed ID:  8673077
  • Title:  Bombyxin-related peptides: cDNA structure and expression in the brain of the hornworm Agrius convolvuli [corrected]